Anti MRPS18A pAb (ATL-HPA035451)

Atlas Antibodies

Catalog No.: ATL-HPA035451-25

Protein Description: mitochondrial ribosomal protein S18A
Gene Name: MRPS18A
Alternative Gene Name: FLJ10548, MRPS18-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023967: 65%, ENSRNOG00000019511: 64%
Entrez Gene ID: 55168
Uniprot ID: Q9NVS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSELQRELQRLSPLPRHSGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH
• Gene Sequence: PSELQRELQRLSPLPRHSGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH
• Gene ID - Mouse: ENSMUSG00000023967
• Gene ID - Rat: ENSRNOG00000019511
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.