Anti MRPS18A pAb (ATL-HPA035450)

Atlas Antibodies

Catalog No.:
ATL-HPA035450-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S18A
Gene Name: MRPS18A
Alternative Gene Name: FLJ10548, MRPS18-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023967: 47%, ENSRNOG00000019511: 46%
Entrez Gene ID: 55168
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGRRPWGPRGAEGCRHSLPTQLPHVSAPPGRKVDIRSVNYTHHPMPTFPLPWAFPL
Gene Sequence DVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGRRPWGPRGAEGCRHSLPTQLPHVSAPPGRKVDIRSVNYTHHPMPTFPLPWAFPL
Gene ID - Mouse ENSMUSG00000023967
Gene ID - Rat ENSRNOG00000019511
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS18A pAb (ATL-HPA035450)
Datasheet Anti MRPS18A pAb (ATL-HPA035450) Datasheet (External Link)
Vendor Page Anti MRPS18A pAb (ATL-HPA035450) at Atlas Antibodies

Documents & Links for Anti MRPS18A pAb (ATL-HPA035450)
Datasheet Anti MRPS18A pAb (ATL-HPA035450) Datasheet (External Link)
Vendor Page Anti MRPS18A pAb (ATL-HPA035450)