Anti ZSWIM7 pAb (ATL-HPA054681)

Atlas Antibodies

Catalog No.: ATL-HPA054681-25

Protein Description: zinc finger, SWIM-type containing 7
Gene Name: ZSWIM7
Alternative Gene Name: SWS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014243: 75%, ENSRNOG00000002970: 86%
Entrez Gene ID: 125150
Uniprot ID: Q19AV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTCQQLSVSDKQLTDILLMEKKQEA
• Gene Sequence: CLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTCQQLSVSDKQLTDILLMEKKQEA
• Gene ID - Mouse: ENSMUSG00000014243
• Gene ID - Rat: ENSRNOG00000002970
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.