Anti ZSWIM3 pAb (ATL-HPA060508)

Atlas Antibodies

SKU: ATL-HPA060508-25

• 

Protein Description: zinc finger, SWIM-type containing 3
Gene Name: ZSWIM3
Alternative Gene Name: C20orf164, dJ337O18.7, PPP1R174
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045822: 75%, ENSRNOG00000015525: 72%
Entrez Gene ID: 140831
Uniprot ID: Q96MP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGMVPNTGQPEKQGRNDMIQDLSRELANLLMQTEGPELEERYSTLRKIVDIWAGPSQPSELFQQPGDFKDVGRLPFLWGKQEEGEGFPPATA
• Gene Sequence: RGMVPNTGQPEKQGRNDMIQDLSRELANLLMQTEGPELEERYSTLRKIVDIWAGPSQPSELFQQPGDFKDVGRLPFLWGKQEEGEGFPPATA
• Gene ID - Mouse: ENSMUSG00000045822
• Gene ID - Rat: ENSRNOG00000015525
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.