Anti ZSCAN10 pAb (ATL-HPA076826)

Atlas Antibodies

Catalog No.: ATL-HPA076826-25

Protein Description: zinc finger and SCAN domain containing 10
Gene Name: ZSCAN10
Alternative Gene Name: ZNF206
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023902: 67%, ENSRNOG00000021782: 61%
Entrez Gene ID: 84891
Uniprot ID: Q96SZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSPWPEESSRDQELAAVLECLTFEDVPENKAWPAHPLGFGSRTPDKEEFKQEEPKGAAWPTPILAESQAD
• Gene Sequence: PSPWPEESSRDQELAAVLECLTFEDVPENKAWPAHPLGFGSRTPDKEEFKQEEPKGAAWPTPILAESQAD
• Gene ID - Mouse: ENSMUSG00000023902
• Gene ID - Rat: ENSRNOG00000021782
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.