Anti ZNRD1 pAb (ATL-HPA077979)

Atlas Antibodies

Catalog No.: ATL-HPA077979-25

Protein Description: zinc ribbon domain containing 1
Gene Name: ZNRD1
Alternative Gene Name: HTEX-6, hZR14, RPA12, tctex-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036315: 87%, ENSRNOG00000000779: 89%
Entrez Gene ID: 30834
Uniprot ID: Q9P1U0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
• Gene Sequence: GTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
• Gene ID - Mouse: ENSMUSG00000036315
• Gene ID - Rat: ENSRNOG00000000779
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.