Anti ZNHIT3 pAb (ATL-HPA078211)

Atlas Antibodies

Catalog No.: ATL-HPA078211-25

Protein Description: zinc finger HIT-type containing 3
Gene Name: ZNHIT3
Alternative Gene Name: TRIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020526: 68%, ENSRNOG00000027818: 68%
Entrez Gene ID: 9326
Uniprot ID: Q15649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSI
• Gene Sequence: MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSI
• Gene ID - Mouse: ENSMUSG00000020526
• Gene ID - Rat: ENSRNOG00000027818
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.