Anti ZNF8 pAb (ATL-HPA034798)

Atlas Antibodies

Catalog No.: ATL-HPA034798-25

Protein Description: zinc finger protein 8
Gene Name: ZNF8
Alternative Gene Name: HF.18, Zfp128
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060397: 41%, ENSRNOG00000031459: 37%
Entrez Gene ID: 7554
Uniprot ID: P17098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LWVAERGTTQGCHPAWEPRSESQASRKEEGLPEEEPSHVTGREGFPTDAPYPTTLGKDRECQSQSLALKEQNN
• Gene Sequence: LWVAERGTTQGCHPAWEPRSESQASRKEEGLPEEEPSHVTGREGFPTDAPYPTTLGKDRECQSQSLALKEQNN
• Gene ID - Mouse: ENSMUSG00000060397
• Gene ID - Rat: ENSRNOG00000031459
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.