Anti ZNF786 pAb (ATL-HPA053459)

Atlas Antibodies

Catalog No.: ATL-HPA053459-100

Protein Description: zinc finger protein 786
Gene Name: ZNF786
Alternative Gene Name: DKFZp762I137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051499: 33%, ENSRNOG00000006925: 34%
Entrez Gene ID: 136051
Uniprot ID: Q8N393
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NADGEMCFRHELTHPSHRLPQQGEKPAQCTPCGKRSLPVDSTQARRCQHSREGPASWREGRGASSSVHSGQKPGSRLPQEGNSHQEG
• Gene Sequence: NADGEMCFRHELTHPSHRLPQQGEKPAQCTPCGKRSLPVDSTQARRCQHSREGPASWREGRGASSSVHSGQKPGSRLPQEGNSHQEG
• Gene ID - Mouse: ENSMUSG00000051499
• Gene ID - Rat: ENSRNOG00000006925
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.