Anti ZNF766 pAb (ATL-HPA044882)

Atlas Antibodies

Catalog No.:
ATL-HPA044882-25
Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells of seminiferus ducts.
Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 766
Gene Name: ZNF766
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027134: 27%, ENSRNOG00000001627: 27%
Entrez Gene ID: 90321
Uniprot ID: Q5HY98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISMMKQRTEPWTVENEMKVAKNPDRWEGIKDINTGRSCAVRSKAGNKPITNQ
Gene Sequence ISMMKQRTEPWTVENEMKVAKNPDRWEGIKDINTGRSCAVRSKAGNKPITNQ
Gene ID - Mouse ENSMUSG00000027134
Gene ID - Rat ENSRNOG00000001627
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF766 pAb (ATL-HPA044882)
Datasheet Anti ZNF766 pAb (ATL-HPA044882) Datasheet (External Link)
Vendor Page Anti ZNF766 pAb (ATL-HPA044882) at Atlas Antibodies

Documents & Links for Anti ZNF766 pAb (ATL-HPA044882)
Datasheet Anti ZNF766 pAb (ATL-HPA044882) Datasheet (External Link)
Vendor Page Anti ZNF766 pAb (ATL-HPA044882)
!