Anti ZNF740 pAb (ATL-HPA035691 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035691-25

Protein Description: zinc finger protein 740
Gene Name: ZNF740
Alternative Gene Name: Zfp740
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046897: 97%, ENSRNOG00000012192: 84%
Entrez Gene ID: 283337
Uniprot ID: Q8NDX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSDKSRSRKDD
• Gene Sequence: AQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSDKSRSRKDD
• Gene ID - Mouse: ENSMUSG00000046897
• Gene ID - Rat: ENSRNOG00000012192
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.