Anti ZNF707 pAb (ATL-HPA044991)

Atlas Antibodies

Catalog No.: ATL-HPA044991-25

Protein Description: zinc finger protein 707
Gene Name: ZNF707
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034429: 32%, ENSRNOG00000003226: 32%
Entrez Gene ID: 286075
Uniprot ID: Q96C28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QWEEPWVEDRERPEFQAVQRGPRPGARKSADPKRHCDHPAWAHKKTHVRRERAREGSSFRKGFRLDTDDGQ
• Gene Sequence: QWEEPWVEDRERPEFQAVQRGPRPGARKSADPKRHCDHPAWAHKKTHVRRERAREGSSFRKGFRLDTDDGQ
• Gene ID - Mouse: ENSMUSG00000034429
• Gene ID - Rat: ENSRNOG00000003226
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.