Anti ZNF674 pAb (ATL-HPA031026)

Atlas Antibodies

Catalog No.: ATL-HPA031026-25

Protein Description: zinc finger protein 674
Gene Name: ZNF674
Alternative Gene Name: MRX92, ZNF673B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033669: 49%, ENSRNOG00000049137: 46%
Entrez Gene ID: 641339
Uniprot ID: Q2M3X9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKHQRTHTGEKPFVCDKCPKAFKSSYHLIRHEKTHIRQAFYKGIKCTTSSLIYQRIHTSEKPQCSEHGKASDEKPSPT
• Gene Sequence: IKHQRTHTGEKPFVCDKCPKAFKSSYHLIRHEKTHIRQAFYKGIKCTTSSLIYQRIHTSEKPQCSEHGKASDEKPSPT
• Gene ID - Mouse: ENSMUSG00000033669
• Gene ID - Rat: ENSRNOG00000049137
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.