Anti ZNF654 pAb (ATL-HPA036172)

Atlas Antibodies

Catalog No.: ATL-HPA036172-25

Protein Description: zinc finger protein 654
Gene Name: ZNF654
Alternative Gene Name: FLJ10997, FLJ21142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047141: 95%, ENSRNOG00000029956: 95%
Entrez Gene ID: 55279
Uniprot ID: Q8IZM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YDLNQETSVIHKINGTVCHPKDIYATDQEGNFKCPALGCVRIFKRIGFLNKHAMTVHPTDLNVRQTVMKWSKG
• Gene Sequence: YDLNQETSVIHKINGTVCHPKDIYATDQEGNFKCPALGCVRIFKRIGFLNKHAMTVHPTDLNVRQTVMKWSKG
• Gene ID - Mouse: ENSMUSG00000047141
• Gene ID - Rat: ENSRNOG00000029956
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.