Anti ZNF584 pAb (ATL-HPA048075)

Atlas Antibodies

Catalog No.: ATL-HPA048075-25

Protein Description: zinc finger protein 584
Gene Name: ZNF584
Alternative Gene Name: FLJ39899
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031907: 41%, ENSRNOG00000020087: 41%
Entrez Gene ID: 201514
Uniprot ID: Q8IVC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEHLKSYRVIQHQDTHSEGKPRRHTEHGAAFPPGSSCGQQQEVHVAEKLFKCSDCG
• Gene Sequence: PEHLKSYRVIQHQDTHSEGKPRRHTEHGAAFPPGSSCGQQQEVHVAEKLFKCSDCG
• Gene ID - Mouse: ENSMUSG00000031907
• Gene ID - Rat: ENSRNOG00000020087
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.