Anti ZNF565 pAb (ATL-HPA044123)

Atlas Antibodies

Catalog No.: ATL-HPA044123-100

Protein Description: zinc finger protein 565
Gene Name: ZNF565
Alternative Gene Name: FLJ36991
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109398: 34%, ENSRNOG00000055519: 32%
Entrez Gene ID: 147929
Uniprot ID: Q8N9K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVTGPWCPDLESRCEKFLQKDIFEIGAFNWEIMESLKCSDLEGSDFRADWECEGQFERQVNEECYFKQVNVTYGHMPVFQHHTSHTV
• Gene Sequence: DVTGPWCPDLESRCEKFLQKDIFEIGAFNWEIMESLKCSDLEGSDFRADWECEGQFERQVNEECYFKQVNVTYGHMPVFQHHTSHTV
• Gene ID - Mouse: ENSMUSG00000109398
• Gene ID - Rat: ENSRNOG00000055519
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.