Anti ZNF512 pAb (ATL-HPA031430)

Atlas Antibodies

Catalog No.: ATL-HPA031430-25

Protein Description: zinc finger protein 512
Gene Name: ZNF512
Alternative Gene Name: KIAA1805
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062761: 91%, ENSRNOG00000039815: 91%
Entrez Gene ID: 84450
Uniprot ID: Q96ME7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKTQPNPKSQARRIRKEPPVYAAGSLEEQWYLEIVDKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTCHHCGKQLRSLAGMKYHVMANH
• Gene Sequence: PKTQPNPKSQARRIRKEPPVYAAGSLEEQWYLEIVDKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTCHHCGKQLRSLAGMKYHVMANH
• Gene ID - Mouse: ENSMUSG00000062761
• Gene ID - Rat: ENSRNOG00000039815
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.