Anti ZNF507 pAb (ATL-HPA030964)

Atlas Antibodies

Catalog No.: ATL-HPA030964-25

Protein Description: zinc finger protein 507
Gene Name: ZNF507
Alternative Gene Name: KIAA1084
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044452: 73%, ENSRNOG00000013565: 74%
Entrez Gene ID: 22847
Uniprot ID: Q8TCN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVIVERLPSAEETLSQKRFLMNTEMEEGKDLSLTEAQIGREGMDDVYRADKCTVDIGGLIIGWSSSEKKDELMNKGLATDENAPP
• Gene Sequence: NVIVERLPSAEETLSQKRFLMNTEMEEGKDLSLTEAQIGREGMDDVYRADKCTVDIGGLIIGWSSSEKKDELMNKGLATDENAPP
• Gene ID - Mouse: ENSMUSG00000044452
• Gene ID - Rat: ENSRNOG00000013565
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.