Anti ZNF423 pAb (ATL-HPA065820)

Atlas Antibodies

Catalog No.: ATL-HPA065820-25

Protein Description: zinc finger protein 423
Gene Name: ZNF423
Alternative Gene Name: Ebfaz, JBTS19, KIAA0760, NPHP14, OAZ, Roaz, Zfp104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045333: 97%, ENSRNOG00000014658: 97%
Entrez Gene ID: 23090
Uniprot ID: Q2M1K9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPDSSNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKV
• Gene Sequence: QPDSSNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKV
• Gene ID - Mouse: ENSMUSG00000045333
• Gene ID - Rat: ENSRNOG00000014658
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.