Anti ZNF263 pAb (ATL-HPA035086)

Atlas Antibodies

Catalog No.: ATL-HPA035086-25

Protein Description: zinc finger protein 263
Gene Name: ZNF263
Alternative Gene Name: FPM315, ZKSCAN12, ZSCAN44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022529: 60%, ENSRNOG00000007678: 60%
Entrez Gene ID: 10127
Uniprot ID: O14978
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGEEKFENLEGVPSVCSENIHPQVLLPDQARGEVPWSPELGRPHDRSQGDWAPPPEGGMEQALAGASSGRELGRPKELQPKKLHLCPL
• Gene Sequence: PGEEKFENLEGVPSVCSENIHPQVLLPDQARGEVPWSPELGRPHDRSQGDWAPPPEGGMEQALAGASSGRELGRPKELQPKKLHLCPL
• Gene ID - Mouse: ENSMUSG00000022529
• Gene ID - Rat: ENSRNOG00000007678
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.