Anti ZMYM4 pAb (ATL-HPA054802)

Atlas Antibodies

Catalog No.: ATL-HPA054802-25

Protein Description: zinc finger, MYM-type 4
Gene Name: ZMYM4
Alternative Gene Name: KIAA0425, MYM, ZNF198L3, ZNF262
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042446: 95%, ENSRNOG00000012397: 96%
Entrez Gene ID: 9202
Uniprot ID: Q5VZL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVRENSKETFSGKEKNRDLTYEREKRLDKPHKDLDSRLKSSFFDKAANQVEETLHTHLPQTPETNFRDSSYPFANKESIGSELG
• Gene Sequence: LVRENSKETFSGKEKNRDLTYEREKRLDKPHKDLDSRLKSSFFDKAANQVEETLHTHLPQTPETNFRDSSYPFANKESIGSELG
• Gene ID - Mouse: ENSMUSG00000042446
• Gene ID - Rat: ENSRNOG00000012397
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.