Anti ZMIZ1 pAb (ATL-HPA071156)

Atlas Antibodies

SKU: ATL-HPA071156-25

• 
• 

Protein Description: zinc finger MIZ-type containing 1
Gene Name: ZMIZ1
Alternative Gene Name: FLJ13541, hZIMP10, KIAA1224, MIZ, RAI17, RP11-519K18.1, Zimp10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007817: 94%, ENSRNOG00000010488: 94%
Entrez Gene ID: 57178
Uniprot ID: Q9ULJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPNYGNQQYGPNSQFPTQPGQYPAPNPPRPLTSPNYPGQRMPSQPSSGQYPPPTVNMGQYYKPEQFNGQNNTFSGSSYSNYSQGNV
• Gene Sequence: EPNYGNQQYGPNSQFPTQPGQYPAPNPPRPLTSPNYPGQRMPSQPSSGQYPPPTVNMGQYYKPEQFNGQNNTFSGSSYSNYSQGNV
• Gene ID - Mouse: ENSMUSG00000007817
• Gene ID - Rat: ENSRNOG00000010488
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.