Anti ZFYVE9 pAb (ATL-HPA065852)

Atlas Antibodies

Catalog No.: ATL-HPA065852-25

Protein Description: zinc finger, FYVE domain containing 9
Gene Name: ZFYVE9
Alternative Gene Name: MADHIP, PPP1R173, SARA, SMADIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034557: 82%, ENSRNOG00000027183: 77%
Entrez Gene ID: 9372
Uniprot ID: O95405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDSYGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSN
• Gene Sequence: QPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDSYGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSN
• Gene ID - Mouse: ENSMUSG00000034557
• Gene ID - Rat: ENSRNOG00000027183
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZFYVE9 pAb (ATL-HPA065852) – 1 Found

Bohl, Bettina; Jabali, Ammar; Ladewig, Julia; Koch, Philipp. Asymmetric Notch activity by differential inheritance of lysosomes in human neural stem cells. Science Advances. 2022;8(6):eabl5792.