Anti ZFYVE28 pAb (ATL-HPA038175)

Atlas Antibodies

Catalog No.: ATL-HPA038175-25

Protein Description: zinc finger, FYVE domain containing 28
Gene Name: ZFYVE28
Alternative Gene Name: KIAA1643
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037224: 77%, ENSRNOG00000014874: 76%
Entrez Gene ID: 57732
Uniprot ID: Q9HCC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GMKLSATVIFNPKSPTSLDSAVATQEAASEPVAEGMDGGPHKLSTGATNCLLHSCVCCGSCGDSREDVVERLREKC
• Gene Sequence: GMKLSATVIFNPKSPTSLDSAVATQEAASEPVAEGMDGGPHKLSTGATNCLLHSCVCCGSCGDSREDVVERLREKC
• Gene ID - Mouse: ENSMUSG00000037224
• Gene ID - Rat: ENSRNOG00000014874
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZFYVE28 pAb (ATL-HPA038175) – 1 Found

Zambrano, Sonia; Rodriguez, Patricia Q; Guo, Jing; Möller-Hackbarth, Katja; Schwarz, Angelina; Patrakka, Jaakko. FYVE domain-containing protein ZFYVE28 regulates EGFR-signaling in podocytes but is not critical for the function of filtration barrier in mice. Scientific Reports. 2018;8(1):4712.