Anti ZFYVE26 pAb (ATL-HPA055500)

Atlas Antibodies

Catalog No.: ATL-HPA055500-25

Protein Description: zinc finger, FYVE domain containing 26
Gene Name: ZFYVE26
Alternative Gene Name: KIAA0321, SPG15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066440: 93%, ENSRNOG00000059875: 91%
Entrez Gene ID: 23503
Uniprot ID: Q68DK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSSKNESPPYSFVVRVPKADEVEWILDLKEEENELVRSEFYYEQAPSASLCIAILNLHRDSIACGHQLIEHCCRLSKGLTNPEVDAGLL
• Gene Sequence: DSSKNESPPYSFVVRVPKADEVEWILDLKEEENELVRSEFYYEQAPSASLCIAILNLHRDSIACGHQLIEHCCRLSKGLTNPEVDAGLL
• Gene ID - Mouse: ENSMUSG00000066440
• Gene ID - Rat: ENSRNOG00000059875
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.