Anti ZFYVE16 pAb (ATL-HPA035936)

Atlas Antibodies

Catalog No.: ATL-HPA035936-25

Protein Description: zinc finger, FYVE domain containing 16
Gene Name: ZFYVE16
Alternative Gene Name: KIAA0305, PPP1R69
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021706: 68%, ENSRNOG00000013055: 67%
Entrez Gene ID: 9765
Uniprot ID: Q7Z3T8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGNEGLPTSGSFTLDDDVFAETEEPSSPTGVLVNSNLPIASISDYRLLCDINKYVCNKISLLPNDEDSLPPLLVASGEKGS
• Gene Sequence: TGNEGLPTSGSFTLDDDVFAETEEPSSPTGVLVNSNLPIASISDYRLLCDINKYVCNKISLLPNDEDSLPPLLVASGEKGS
• Gene ID - Mouse: ENSMUSG00000021706
• Gene ID - Rat: ENSRNOG00000013055
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.