Anti ZFAND6 pAb (ATL-HPA034845)

Atlas Antibodies

Catalog No.:
ATL-HPA034845-25
Immunohistochemical staining of human kidney shows weak cytoplasmic positivity in cells in tubules.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger, AN1-type domain 6
Gene Name: ZFAND6
Alternative Gene Name: AWP1, ZA20D3, ZFAND5B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030629: 91%, ENSRNOG00000013506: 91%
Entrez Gene ID: 54469
Uniprot ID: Q6FIF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDK
Gene Sequence SSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDK
Gene ID - Mouse ENSMUSG00000030629
Gene ID - Rat ENSRNOG00000013506
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZFAND6 pAb (ATL-HPA034845)
Datasheet Anti ZFAND6 pAb (ATL-HPA034845) Datasheet (External Link)
Vendor Page Anti ZFAND6 pAb (ATL-HPA034845) at Atlas Antibodies

Documents & Links for Anti ZFAND6 pAb (ATL-HPA034845)
Datasheet Anti ZFAND6 pAb (ATL-HPA034845) Datasheet (External Link)
Vendor Page Anti ZFAND6 pAb (ATL-HPA034845)
Citations for Anti ZFAND6 pAb (ATL-HPA034845) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed
!