Anti ZCCHC8 pAb (ATL-HPA037484)

Atlas Antibodies

Catalog No.: ATL-HPA037484-25

Protein Description: zinc finger, CCHC domain containing 8
Gene Name: ZCCHC8
Alternative Gene Name: DKFZp434E2220
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029427: 94%, ENSRNOG00000001243: 94%
Entrez Gene ID: 55596
Uniprot ID: Q6NZY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QYHQEIEEFVSNLVKRFEEQQKNDVEKTSFNLLPQPSSIVLEEDHKVEESCAIKNNKEAFSVVGSVLYFTNFCLDKLGQPLLNENPQLSEGWEIPKYH
• Gene Sequence: QYHQEIEEFVSNLVKRFEEQQKNDVEKTSFNLLPQPSSIVLEEDHKVEESCAIKNNKEAFSVVGSVLYFTNFCLDKLGQPLLNENPQLSEGWEIPKYH
• Gene ID - Mouse: ENSMUSG00000029427
• Gene ID - Rat: ENSRNOG00000001243
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZCCHC8 pAb (ATL-HPA037484) – 1 Found

Mure, Fabrice; Corbin, Antoine; Benbahouche, Nour El Houda; Bertrand, Edouard; Manet, Evelyne; Gruffat, Henri. The splicing factor SRSF3 is functionally connected to the nuclear RNA exosome for intronless mRNA decay. Scientific Reports. 2018;8(1):12901.