Anti ZCCHC8 pAb (ATL-HPA037483)

Atlas Antibodies

Catalog No.: ATL-HPA037483-25

Protein Description: zinc finger, CCHC domain containing 8
Gene Name: ZCCHC8
Alternative Gene Name: DKFZp434E2220
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029427: 84%, ENSRNOG00000001243: 85%
Entrez Gene ID: 55596
Uniprot ID: Q6NZY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGWLKEAELENSGLALYDGKDGTDGETEVGEIQQNKSVTYDLSKLVNYPGFNISTPRGIPDEWRIFGSIPMQACQQKDVFANYLTSNFQAPGVKSGNK
• Gene Sequence: PGWLKEAELENSGLALYDGKDGTDGETEVGEIQQNKSVTYDLSKLVNYPGFNISTPRGIPDEWRIFGSIPMQACQQKDVFANYLTSNFQAPGVKSGNK
• Gene ID - Mouse: ENSMUSG00000029427
• Gene ID - Rat: ENSRNOG00000001243
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.