Anti ZCCHC17 pAb (ATL-HPA053727)

Atlas Antibodies

Catalog No.: ATL-HPA053727-25

Protein Description: zinc finger, CCHC domain containing 17
Gene Name: ZCCHC17
Alternative Gene Name: HSPC251, pNO40, PS1D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000108747: 100%, ENSRNOG00000012266: 100%
Entrez Gene ID: 51538
Uniprot ID: Q9NP64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMK
• Gene Sequence: MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMK
• Gene ID - Mouse: ENSMUSG00000108747
• Gene ID - Rat: ENSRNOG00000012266
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.