Anti ZCCHC12 pAb (ATL-HPA034940)

Atlas Antibodies

Catalog No.: ATL-HPA034940-25

Protein Description: zinc finger, CCHC domain containing 12
Gene Name: ZCCHC12
Alternative Gene Name: FLJ16123, PNMA7A, SIZN, SIZN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036699: 74%, ENSRNOG00000013162: 70%
Entrez Gene ID: 170261
Uniprot ID: Q6PEW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVLVIDSPHNSRAQFPSTSGGSGYKNNGPGEMRRARKRKHTIRCSYCGEEGHSKETCDNESDKAQVFENLIITLQELTHTEMERSRVAPGEYNDFSE
• Gene Sequence: EVLVIDSPHNSRAQFPSTSGGSGYKNNGPGEMRRARKRKHTIRCSYCGEEGHSKETCDNESDKAQVFENLIITLQELTHTEMERSRVAPGEYNDFSE
• Gene ID - Mouse: ENSMUSG00000036699
• Gene ID - Rat: ENSRNOG00000013162
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.