Anti ZC3HAV1L pAb (ATL-HPA050741)

Atlas Antibodies

Catalog No.: ATL-HPA050741-25

Protein Description: zinc finger CCCH-type, antiviral 1-like
Gene Name: ZC3HAV1L
Alternative Gene Name: C7orf39, MGC14289
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047749: 84%, ENSRNOG00000013944: 88%
Entrez Gene ID: 92092
Uniprot ID: Q96H79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDCWSTCTLSHDIHTPVNMQVLKSHGLFGLNENQLRILLLQNDPCLLPEVCLLYNKGEALYGYCNLKDKCNKFHVCKSF
• Gene Sequence: RDCWSTCTLSHDIHTPVNMQVLKSHGLFGLNENQLRILLLQNDPCLLPEVCLLYNKGEALYGYCNLKDKCNKFHVCKSF
• Gene ID - Mouse: ENSMUSG00000047749
• Gene ID - Rat: ENSRNOG00000013944
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.