Anti ZC3H8 pAb (ATL-HPA034803)

Atlas Antibodies

Catalog No.: ATL-HPA034803-25

Protein Description: zinc finger CCCH-type containing 8
Gene Name: ZC3H8
Alternative Gene Name: Fliz1, ZC3HDC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027387: 67%, ENSRNOG00000017647: 63%
Entrez Gene ID: 84524
Uniprot ID: Q8N5P1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLKAGHKNGKQKKMKRKWPGPGNKGSNALLRNSGSQEEDGKPKEKQQHLSQAFINQHT
• Gene Sequence: NLKAGHKNGKQKKMKRKWPGPGNKGSNALLRNSGSQEEDGKPKEKQQHLSQAFINQHT
• Gene ID - Mouse: ENSMUSG00000027387
• Gene ID - Rat: ENSRNOG00000017647
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.