Anti ZC3H6 pAb (ATL-HPA036019)

Atlas Antibodies

Catalog No.: ATL-HPA036019-25

Protein Description: zinc finger CCCH-type containing 6
Gene Name: ZC3H6
Alternative Gene Name: FLJ41410, FLJ45877, KIAA2035, ZC3HDC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042851: 66%, ENSRNOG00000026277: 66%
Entrez Gene ID: 376940
Uniprot ID: P61129
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YHSPGFPGHVMKVPRENHCSPGSSYQQSPGEMQLNTNYESLQNPAEFYDNYYAQHSIHNFQPPNNSGDGMWHGEFAQQQPPVVQDSPNHGSGS
• Gene Sequence: YHSPGFPGHVMKVPRENHCSPGSSYQQSPGEMQLNTNYESLQNPAEFYDNYYAQHSIHNFQPPNNSGDGMWHGEFAQQQPPVVQDSPNHGSGS
• Gene ID - Mouse: ENSMUSG00000042851
• Gene ID - Rat: ENSRNOG00000026277
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.