Anti ZC3H15 pAb (ATL-HPA031099 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031099-25

Protein Description: zinc finger CCCH-type containing 15
Gene Name: ZC3H15
Alternative Gene Name: LEREPO4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027091: 97%, ENSRNOG00000005256: 97%
Entrez Gene ID: 55854
Uniprot ID: Q8WU90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVCKHFLEAIENNKYGWFWVCPGGGDICMYRHALPPGFVLKKDKKKEEKEDEISLEDLIERERSALGPNVTKITL
• Gene Sequence: IVCKHFLEAIENNKYGWFWVCPGGGDICMYRHALPPGFVLKKDKKKEEKEDEISLEDLIERERSALGPNVTKITL
• Gene ID - Mouse: ENSMUSG00000027091
• Gene ID - Rat: ENSRNOG00000005256
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZC3H15 pAb (ATL-HPA031099 w/enhanced validation) – 1 Found

Markolovic, Suzana; Zhuang, Qinqin; Wilkins, Sarah E; Eaton, Charlotte D; Abboud, Martine I; Katz, Maximiliano J; McNeil, Helen E; Leśniak, Robert K; Hall, Charlotte; Struwe, Weston B; Konietzny, Rebecca; Davis, Simon; Yang, Ming; Ge, Wei; Benesch, Justin L P; Kessler, Benedikt M; Ratcliffe, Peter J; Cockman, Matthew E; Fischer, Roman; Wappner, Pablo; Chowdhury, Rasheduzzaman; Coleman, Mathew L; Schofield, Christopher J. The Jumonji-C oxygenase JMJD7 catalyzes (3S)-lysyl hydroxylation of TRAFAC GTPases. Nature Chemical Biology. 2018;14(7):688-695.