Anti ZC3H12D pAb (ATL-HPA036897 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036897-25

Protein Description: zinc finger CCCH-type containing 12D
Gene Name: ZC3H12D
Alternative Gene Name: C6orf95, dJ281H8.1, MCPIP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039981: 63%, ENSRNOG00000016041: 64%
Entrez Gene ID: 340152
Uniprot ID: A2A288
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLA
• Gene Sequence: GYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLA
• Gene ID - Mouse: ENSMUSG00000039981
• Gene ID - Rat: ENSRNOG00000016041
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.