Anti ZC3H10 pAb (ATL-HPA062265)

Atlas Antibodies

Catalog No.: ATL-HPA062265-25

Protein Description: zinc finger CCCH-type containing 10
Gene Name: ZC3H10
Alternative Gene Name: FLJ14451, ZC3HDC10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039810: 91%, ENSRNOG00000040281: 91%
Entrez Gene ID: 84872
Uniprot ID: Q96K80
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENAMLRKRVEEL
• Gene Sequence: RGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENAMLRKRVEEL
• Gene ID - Mouse: ENSMUSG00000039810
• Gene ID - Rat: ENSRNOG00000040281
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.