Anti ZBTB8A pAb (ATL-HPA031768)

Atlas Antibodies

Catalog No.: ATL-HPA031768-25

Protein Description: zinc finger and BTB domain containing 8A
Gene Name: ZBTB8A
Alternative Gene Name: BOZF1, FLJ90065, ZBTB8, ZNF916A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028807: 68%, ENSRNOG00000008300: 77%
Entrez Gene ID: 653121
Uniprot ID: Q96BR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFIKSSLDISEKEKDRYFSLSDKDANSNGVERSSFYSGGWQEGSSSPRSHLSPEQGTGIISGKSWNKYNYHPASQKNTQQP
• Gene Sequence: TFIKSSLDISEKEKDRYFSLSDKDANSNGVERSSFYSGGWQEGSSSPRSHLSPEQGTGIISGKSWNKYNYHPASQKNTQQP
• Gene ID - Mouse: ENSMUSG00000028807
• Gene ID - Rat: ENSRNOG00000008300
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.