Anti ZBTB47 pAb (ATL-HPA074057)

Atlas Antibodies

Catalog No.: ATL-HPA074057-25

Protein Description: zinc finger and BTB domain containing 47
Gene Name: ZBTB47
Alternative Gene Name: DKFZp434N0615, KIAA1190, ZNF651
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013419: 60%, ENSRNOG00000019382: 60%
Entrez Gene ID: 92999
Uniprot ID: Q9UFB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAGGKQGPRGSRSSRADPPPHSHMATRSRENARRRGTPEPEEAGRRGGKRPKPPPGVASASARG
• Gene Sequence: EAGGKQGPRGSRSSRADPPPHSHMATRSRENARRRGTPEPEEAGRRGGKRPKPPPGVASASARG
• Gene ID - Mouse: ENSMUSG00000013419
• Gene ID - Rat: ENSRNOG00000019382
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.