Anti ZBTB3 pAb (ATL-HPA035321)

Atlas Antibodies

Catalog No.: ATL-HPA035321-25

Protein Description: zinc finger and BTB domain containing 3
Gene Name: ZBTB3
Alternative Gene Name: FLJ23392
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034863: 28%, ENSRNOG00000058662: 28%
Entrez Gene ID: 79842
Uniprot ID: Q9H5J0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLREFSKWGVEASPGKAWERKRSLLRGAVGRYRGATGGDLFWAPFPSWGTMEFPEHSQQL
• Gene Sequence: MLREFSKWGVEASPGKAWERKRSLLRGAVGRYRGATGGDLFWAPFPSWGTMEFPEHSQQL
• Gene ID - Mouse: ENSMUSG00000034863
• Gene ID - Rat: ENSRNOG00000058662
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.