Anti ZBBX pAb (ATL-HPA036328 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036328-25

Protein Description: zinc finger, B-box domain containing
Gene Name: ZBBX
Alternative Gene Name: FLJ23049
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034151: 52%, ENSRNOG00000009792: 49%
Entrez Gene ID: 79740
Uniprot ID: A8MT70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QHTLDNLEKELQVLRSLADTSEKLYSLTSEEFPDFSSQSLNISQISTDFLKTSHVRGPCGVEELSCSGRDTKIQSLLSLSESSTDEEEEDFLNKQ
• Gene Sequence: QHTLDNLEKELQVLRSLADTSEKLYSLTSEEFPDFSSQSLNISQISTDFLKTSHVRGPCGVEELSCSGRDTKIQSLLSLSESSTDEEEEDFLNKQ
• Gene ID - Mouse: ENSMUSG00000034151
• Gene ID - Rat: ENSRNOG00000009792
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.