Anti YIPF1 pAb (ATL-HPA073931)

Atlas Antibodies

Catalog No.: ATL-HPA073931-25

Protein Description: Yip1 domain family member 1
Gene Name: YIPF1
Alternative Gene Name: DJ167A19.1, FinGER1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057375: 71%, ENSRNOG00000010512: 73%
Entrez Gene ID: 54432
Uniprot ID: Q9Y548
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAAVDDLQFEEFGNAATSLTANPDATTVNIEDPGETPKHQPGSPRGSGREED
• Gene Sequence: MAAVDDLQFEEFGNAATSLTANPDATTVNIEDPGETPKHQPGSPRGSGREED
• Gene ID - Mouse: ENSMUSG00000057375
• Gene ID - Rat: ENSRNOG00000010512
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.