Anti YBX1 pAb (ATL-HPA040304 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040304-100

Protein Description: Y box binding protein 1
Gene Name: YBX1
Alternative Gene Name: BP-8, CSDA2, CSDB, DBPB, MDR-NF1, NSEP-1, NSEP1, YB-1, YB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028639: 99%, ENSRNOG00000032902: 99%
Entrez Gene ID: 4904
Uniprot ID: P67809
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDK
• Gene Sequence: SGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDK
• Gene ID - Mouse: ENSMUSG00000028639
• Gene ID - Rat: ENSRNOG00000032902
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti YBX1 pAb (ATL-HPA040304 w/enhanced validation) – 1 Found

Lefort, Sylvain; El-Naggar, Amal; Tan, Susanna; Colborne, Shane; Negri, Gian Luca; Pellacani, Davide; Hirst, Martin; Gusterson, Barry; Morin, Gregg B; Sorensen, Poul H; Eaves, Connie J. De novo and cell line models of human mammary cell transformation reveal an essential role for Yb-1 in multiple stages of human breast cancer. Cell Death And Differentiation. 2022;29(1):54-64.