Anti YAE1D1 pAb (ATL-HPA031249)

Atlas Antibodies

Catalog No.: ATL-HPA031249-25

Protein Description: Yae1 domain containing 1
Gene Name: YAE1D1
Alternative Gene Name: C7orf36, GK003
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075054: 83%, ENSRNOG00000013438: 87%
Entrez Gene ID: 57002
Uniprot ID: Q9NRH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDVFDEEADESLLAQREWQSNMQRRVKEGYRDGIDAGKAVTLQQGFNQGYKKGAEVILNYGRLRGTLSALLSWCH
• Gene Sequence: GDVFDEEADESLLAQREWQSNMQRRVKEGYRDGIDAGKAVTLQQGFNQGYKKGAEVILNYGRLRGTLSALLSWCH
• Gene ID - Mouse: ENSMUSG00000075054
• Gene ID - Rat: ENSRNOG00000013438
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.