Anti XYLB pAb (ATL-HPA037863)

Atlas Antibodies

Catalog No.: ATL-HPA037863-25

Protein Description: xylulokinase homolog (H. influenzae)
Gene Name: XYLB
Alternative Gene Name: FLJ10343, FLJ12539
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035769: 84%, ENSRNOG00000014168: 81%
Entrez Gene ID: 9942
Uniprot ID: O75191
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDV
• Gene Sequence: DSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDV
• Gene ID - Mouse: ENSMUSG00000035769
• Gene ID - Rat: ENSRNOG00000014168
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.