Anti XKR3 pAb (ATL-HPA035081)

Atlas Antibodies

Catalog No.: ATL-HPA035081-25

Protein Description: XK, Kell blood group complex subunit-related family, member 3
Gene Name: XKR3
Alternative Gene Name: MGC57211, XTES
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020115: 40%, ENSRNOG00000020321: 38%
Entrez Gene ID: 150165
Uniprot ID: Q5GH77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: METVFEEMDEESTGGVSSSKEEIVLGQRLH
• Gene Sequence: METVFEEMDEESTGGVSSSKEEIVLGQRLH
• Gene ID - Mouse: ENSMUSG00000020115
• Gene ID - Rat: ENSRNOG00000020321
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.