Anti XIRP2 pAb (ATL-HPA034813)

Atlas Antibodies

Catalog No.: ATL-HPA034813-25

Protein Description: xin actin-binding repeat containing 2
Gene Name: XIRP2
Alternative Gene Name: CMYA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027022: 73%, ENSRNOG00000034258: 75%
Entrez Gene ID: 129446
Uniprot ID: A4UGR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HAPPTYEDVIAGHILDISDSPKEVRKNFQKTWQESGRVFKGLGYATADASATEMRTTFQEESAFISEAAAPRQGNMYTLSKDSLSNGVP
• Gene Sequence: HAPPTYEDVIAGHILDISDSPKEVRKNFQKTWQESGRVFKGLGYATADASATEMRTTFQEESAFISEAAAPRQGNMYTLSKDSLSNGVP
• Gene ID - Mouse: ENSMUSG00000027022
• Gene ID - Rat: ENSRNOG00000034258
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti XIRP2 pAb (ATL-HPA034813) – 1 Found

Murgia, Marta; Nogara, Leonardo; Baraldo, Martina; Reggiani, Carlo; Mann, Matthias; Schiaffino, Stefano. Protein profile of fiber types in human skeletal muscle: a single-fiber proteomics study. Skeletal Muscle. 2021;11(1):24.