Anti WHAMM pAb (ATL-HPA039690)

Atlas Antibodies

Catalog No.: ATL-HPA039690-25

Protein Description: WAS protein homolog associated with actin, golgi membranes and microtubules
Gene Name: WHAMM
Alternative Gene Name: KIAA1971, WHDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045795: 54%, ENSRNOG00000028113: 54%
Entrez Gene ID: 123720
Uniprot ID: Q8TF30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RALSSSSQAATHQNLGFRAPVKDDQPRPLVCESPAERPRDSLESFSCPGSMDEVLASLRHGRAPLRKVEVPAVRPPHASINEHILAAIR
• Gene Sequence: RALSSSSQAATHQNLGFRAPVKDDQPRPLVCESPAERPRDSLESFSCPGSMDEVLASLRHGRAPLRKVEVPAVRPPHASINEHILAAIR
• Gene ID - Mouse: ENSMUSG00000045795
• Gene ID - Rat: ENSRNOG00000028113
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.