Anti WDR59 pAb (ATL-HPA041084)

Atlas Antibodies

Catalog No.: ATL-HPA041084-25

Protein Description: WD repeat domain 59
Gene Name: WDR59
Alternative Gene Name: FLJ12270
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031959: 96%, ENSRNOG00000018967: 99%
Entrez Gene ID: 79726
Uniprot ID: Q6PJI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSSQDNSVKFWDYRQPRKYLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNVFDLNTPVHTFVGHDDVVLEFQWRKQKEGSKD
• Gene Sequence: TSSQDNSVKFWDYRQPRKYLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNVFDLNTPVHTFVGHDDVVLEFQWRKQKEGSKD
• Gene ID - Mouse: ENSMUSG00000031959
• Gene ID - Rat: ENSRNOG00000018967
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.