Anti WDR37 pAb (ATL-HPA037565 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037565-25

Protein Description: WD repeat domain 37
Gene Name: WDR37
Alternative Gene Name: KIAA0982
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021147: 96%, ENSRNOG00000016834: 81%
Entrez Gene ID: 22884
Uniprot ID: Q9Y2I8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TARQTKQKRKSHSLSIRRTNSSEQERTGLPRDMLEGQDSKLPSSVRSTLLELFGQIEREFENLYIENLELRREIDTLNERLAAEG
• Gene Sequence: TARQTKQKRKSHSLSIRRTNSSEQERTGLPRDMLEGQDSKLPSSVRSTLLELFGQIEREFENLYIENLELRREIDTLNERLAAEG
• Gene ID - Mouse: ENSMUSG00000021147
• Gene ID - Rat: ENSRNOG00000016834
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.